TTC12 Antikörper (C-Term)

Produktnummer ABIN631929

Produktdetails anti-TTC12 Antikörper

Target: TTC12 (Tetratricopeptide Repeat Domain 12 (TTC12))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TTC12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TTC12 antibody was raised against the C terminal of TTC12

Aufreinigung: Affinity purified

Immunogen: TTC12 antibody was raised using the C terminal of TTC12 corresponding to a region with amino acids MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TTC12 Blocking Peptide, catalog no. 33R-6251, is also available for use as a blocking control in assays to test for specificity of this TTC12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TTC12

Target: TTC12 (Tetratricopeptide Repeat Domain 12 (TTC12))

Andere Bezeichnung: TTC12 (TTC12 Produkte)

Synonyme: TPARM antikoerper, E330017O07Rik antikoerper, tetratricopeptide repeat domain 12 antikoerper, TTC12 antikoerper, Ttc12 antikoerper

Hintergrund: TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.

Molekulargewicht: 81 kDa (MW of target protein)