NRARP Antikörper (Middle Region)

Produktnummer ABIN631926

Produktdetails anti-NRARP Antikörper

Target: NRARP (NOTCH-Regulated Ankyrin Repeat Protein (NRARP))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NRARP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NRARP antibody was raised against the middle region of NRARP

Aufreinigung: Affinity purified

Immunogen: NRARP antibody was raised using the middle region of NRARP corresponding to a region with amino acids QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NRARP Blocking Peptide, catalog no. 33R-7666, is also available for use as a blocking control in assays to test for specificity of this NRARP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRARP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NRARP

Target: NRARP (NOTCH-Regulated Ankyrin Repeat Protein (NRARP))

Andere Bezeichnung: NRARP (NRARP Produkte)

Synonyme: 2700054M22Rik antikoerper, Nrarp-a antikoerper, fc89b12 antikoerper, id:ibd2282 antikoerper, wu:fa14d10 antikoerper, wu:fc89b12 antikoerper, zgc:100826 antikoerper, Nrarp-b antikoerper, zgc:101875 antikoerper, Notch-regulated ankyrin repeat protein antikoerper, NOTCH regulated ankyrin repeat protein antikoerper, NOTCH regulated ankyrin repeat protein S homeolog antikoerper, NOTCH-regulated ankyrin repeat protein antikoerper, NOTCH regulated ankyrin repeat protein a antikoerper, NOTCH regulated ankyrin repeat protein b antikoerper, Nrarp antikoerper, NRARP antikoerper, nrarp.S antikoerper, nrarpa antikoerper, nrarpb antikoerper

Hintergrund: NRARP may play a role in the formation of somites.

Molekulargewicht: 12 kDa (MW of target protein)