C16orf78 Antikörper (Middle Region)

Produktnummer ABIN631923

Produktdetails anti-C16orf78 Antikörper

Target: C16orf78 (Chromosome 16 Open Reading Frame 78 (C16orf78))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C16orf78 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C16 ORF78 antibody was raised against the middle region of C16 rf78

Aufreinigung: Affinity purified

Immunogen: C16 ORF78 antibody was raised using the middle region of C16 rf78 corresponding to a region with amino acids GVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C16ORF78 Blocking Peptide, catalog no. 33R-3634, is also available for use as a blocking control in assays to test for specificity of this C16ORF78 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF78 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C16orf78

Target: C16orf78 (Chromosome 16 Open Reading Frame 78 (C16orf78))

Andere Bezeichnung: C16ORF78 (C16orf78 Produkte)

Synonyme: chromosome 16 open reading frame 78 antikoerper, C16orf78 antikoerper

Hintergrund: The function of C16orf78 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 34 kDa (MW of target protein)