DOK5 Antikörper (N-Term)

Produktnummer ABIN631914

Dieses Anti-DOK5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DOK5 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für DOK5 Antikörper (N-Term) (ABIN631914)

Target: DOK5 (Docking Protein 5 (DOK5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DOK5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DOK5 Antikörper

Bindungsspezifität: N-Term

Spezifität: DOK5 antibody was raised against the N terminal of DOK5

Aufreinigung: Affinity purified

Immunogen: DOK5 antibody was raised using the N terminal of DOK5 corresponding to a region with amino acids GPKRLEKFSDERAAYFRCYHKVTELNNVKNVARLPKSTKKHAIGIYFNDD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DOK5 Blocking Peptide, catalog no. 33R-3474, is also available for use as a blocking control in assays to test for specificity of this DOK5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOK5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DOK5

Target: DOK5 (Docking Protein 5 (DOK5))

Andere Bezeichnung: DOK5

Hintergrund: DOK5 is a member of the DOK family of membrane proteins, which are adapter proteins involved in signal transduction. It interacts with phosphorylated receptor tyrosine kinases to mediate neurite outgrowth and activation of the MAP kinase pathway. In contrast to other DOK family proteins, this protein does not interact with RASGAP.

Molekulargewicht: 34 kDa (MW of target protein)