Pellino 3 Antikörper

Produktnummer ABIN631913

Der Kaninchen Polyklonal anti-Pellino 3 Antikörper wird verwendet zum Nachweis von Pellino 3 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Pellino 3 Antikörper (ABIN631913)

Target: Pellino 3 (PELI3) (Pellino E3 Ubiquitin Protein Ligase Family Member 3 (PELI3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Pellino 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Pellino 3 Antikörper

Aufreinigung: Affinity purified

Immunogen: PELI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PELI3 Blocking Peptide, (ABIN5615306), is also available for use as a blocking control in assays to test for specificity of this PELI3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PELI3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Pellino 3

Target: Pellino 3 (PELI3) (Pellino E3 Ubiquitin Protein Ligase Family Member 3 (PELI3))

Andere Bezeichnung: PELI3

Hintergrund: Toll-like receptors (TLRs) and IL1R (IL1R1) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Toll-Like Receptors Cascades