DNALI1 Antikörper (N-Term)

Produktnummer ABIN631888

Produktdetails anti-DNALI1 Antikörper

Target: DNALI1 (Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNALI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DNALI1 antibody was raised against the N terminal of DNALI1

Aufreinigung: Affinity purified

Immunogen: DNALI1 antibody was raised using the N terminal of DNALI1 corresponding to a region with amino acids MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNALI1 Blocking Peptide, catalog no. 33R-6612, is also available for use as a blocking control in assays to test for specificity of this DNALI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNALI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNALI1

Target: DNALI1 (Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1))

Andere Bezeichnung: DNALI1 (DNALI1 Produkte)

Synonyme: zgc:171493 antikoerper, zgc:171595 antikoerper, P28 antikoerper, dJ423B22.5 antikoerper, hp28 antikoerper, 1700023A09Rik antikoerper, AW049135 antikoerper, dynein axonemal light intermediate chain 1 antikoerper, dynein, axonemal, light intermediate chain 1 antikoerper, dynein axonemal light intermediate chain 1 S homeolog antikoerper, dynein, axonemal, light intermediate polypeptide 1 antikoerper, DNALI1 antikoerper, dnali1 antikoerper, dnali1.S antikoerper, Dnali1 antikoerper

Hintergrund: DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.

Molekulargewicht: 31 kDa (MW of target protein)