WDR55 Antikörper (Middle Region)

Produktnummer ABIN631883

Produktdetails anti-WDR55 Antikörper

Target: WDR55 (WD Repeat Domain 55 (WDR55))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR55 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR55 antibody was raised against the middle region of WDR55

Aufreinigung: Affinity purified

Immunogen: WDR55 antibody was raised using the middle region of WDR55 corresponding to a region with amino acids AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR55 Blocking Peptide, catalog no. 33R-1298, is also available for use as a blocking control in assays to test for specificity of this WDR55 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR55 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR55

Target: WDR55 (WD Repeat Domain 55 (WDR55))

Andere Bezeichnung: WDR55 (WDR55 Produkte)

Synonyme: MGC146726 antikoerper, 2410080P20Rik antikoerper, C80692 antikoerper, LRRG00133 antikoerper, RGD1305640 antikoerper, flj20195l antikoerper, zgc:111796 antikoerper, WD repeat domain 55 antikoerper, WDR55 antikoerper, wdr55 antikoerper, Wdr55 antikoerper

Hintergrund: WDR55 is a nucleolar protein that acts as a modulator of rRNA synthesis. WDR55 plays a central role during organogenesis.

Molekulargewicht: 42 kDa (MW of target protein)