Nop10 Antikörper (Middle Region)
-
- Target Alle Nop10 Antikörper anzeigen
- Nop10 (NOP10 Ribonucleoprotein Homolog (Nop10))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Nop10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NOLA3 antibody was raised against the middle region of Nola3
- Aufreinigung
- Affinity purified
- Immunogen
- NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK
- Top Product
- Discover our top product Nop10 Primärantikörper
-
anti-NOP10 Ribonucleoprotein Homolog (Nop10) (AA 1-64) antibody
Nop10 Reaktivität: Human ELISA, WB Wirt: Maus Monoclonal 6H6 unconjugated
anti-NOP10 Ribonucleoprotein Homolog (Nop10) antibodyNop10 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-NOP10 Ribonucleoprotein Homolog (Nop10) (N-Term) antibodyNop10 Reaktivität: Human, Maus, Schwein, Ratte, Hund, Pferd, Fledermaus, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-NOP10 Ribonucleoprotein Homolog (Nop10) (Middle Region) antibodyNop10 Reaktivität: Human, Maus, Schwein, Ratte, Hund, Pferd, Rind (Kuh), Meerschweinchen, Kaninchen, Saccharomyces cerevisiae, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NOLA3 Blocking Peptide, catalog no. 33R-5997, is also available for use as a blocking control in assays to test for specificity of this NOLA3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOLA3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nop10 (NOP10 Ribonucleoprotein Homolog (Nop10))
- Andere Bezeichnung
- NOLA3 (Nop10 Produkte)
- Synonyme
- DKCB1 antikoerper, NOLA3 antikoerper, NOP10P antikoerper, 1110036B12Rik antikoerper, Nola3 antikoerper, nola3 antikoerper, zgc:109956 antikoerper, NOP10 ribonucleoprotein antikoerper, NOP10 ribonucleoprotein homolog (yeast) antikoerper, NOP10 antikoerper, Nop10 antikoerper, nop10 antikoerper
- Hintergrund
- This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.
- Molekulargewicht
- 8 kDa (MW of target protein)
-
