Nop10 Antikörper (Middle Region)

Produktnummer ABIN631878

Dieser Anti-Nop10 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von Nop10 in WB. Geeignet für Human.

Kurzübersicht für Nop10 Antikörper (Middle Region) (ABIN631878)

Target: Nop10 (NOP10 Ribonucleoprotein Homolog (Nop10))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Nop10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Nop10 Antikörper

Bindungsspezifität: Middle Region

Spezifität: NOLA3 antibody was raised against the middle region of Nola3

Aufreinigung: Affinity purified

Immunogen: NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOLA3 Blocking Peptide, (ABIN5615023), is also available for use as a blocking control in assays to test for specificity of this NOLA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOLA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Nop10

Target: Nop10 (NOP10 Ribonucleoprotein Homolog (Nop10))

Andere Bezeichnung: NOLA3

Hintergrund: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.

Molekulargewicht: 8 kDa (MW of target protein)