CCDC54 Antikörper (N-Term)

Produktnummer ABIN631876

Produktdetails anti-CCDC54 Antikörper

Target: CCDC54 (Coiled-Coil Domain Containing 54 (CCDC54))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC54 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCDC54 antibody was raised against the N terminal of CCDC54

Aufreinigung: Affinity purified

Immunogen: CCDC54 antibody was raised using the N terminal of CCDC54 corresponding to a region with amino acids MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC54 Blocking Peptide, catalog no. 33R-6277, is also available for use as a blocking control in assays to test for specificity of this CCDC54 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC54 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC54

Target: CCDC54 (Coiled-Coil Domain Containing 54 (CCDC54))

Andere Bezeichnung: CCDC54 (CCDC54 Produkte)

Synonyme: CCDC54 antikoerper, NYD-SP17 antikoerper, SP17 antikoerper, 1700007N18Rik antikoerper, AI644412 antikoerper, BB013989 antikoerper, RGD1559779 antikoerper, coiled-coil domain containing 54 antikoerper, CCDC54 antikoerper, Ccdc54 antikoerper

Hintergrund: The specific function of CCDC54 is not yet known.

Molekulargewicht: 36 kDa (MW of target protein)