NCRNA00114 Antikörper (N-Term)

Produktnummer ABIN631869

Produktdetails anti-NCRNA00114 Antikörper

Target: NCRNA00114 (Non-Protein Coding RNA 114 (NCRNA00114))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NCRNA00114 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NCRNA00114 antibody was raised against the N terminal Of Ncrna00114

Aufreinigung: Affinity purified

Immunogen: NCRNA00114 antibody was raised using the N terminal Of Ncrna00114 corresponding to a region with amino acids SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NCRNA00114 Blocking Peptide, catalog no. 33R-8438, is also available for use as a blocking control in assays to test for specificity of this NCRNA00114 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCRNA00114 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NCRNA00114

Target: NCRNA00114 (Non-Protein Coding RNA 114 (NCRNA00114))

Andere Bezeichnung: NCRNA00114 (NCRNA00114 Produkte)

Synonyme: C21orf24 antikoerper, NCRNA00114 antikoerper, long intergenic non-protein coding RNA 114 antikoerper, LINC00114 antikoerper

Hintergrund: The specific function of NCRNA00114 is not yet known.

Molekulargewicht: 15 kDa (MW of target protein)