C1orf55 Antikörper (C-Term)

Produktnummer ABIN631867

Produktdetails anti-C1orf55 Antikörper

Target: C1orf55 (Chromosome 1 Open Reading Frame 55 (C1orf55))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1orf55 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 ORF55 antibody was raised against the C terminal Of C1 rf55

Aufreinigung: Affinity purified

Immunogen: C1 ORF55 antibody was raised using the C terminal Of C1 rf55 corresponding to a region with amino acids AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF55 Blocking Peptide, catalog no. 33R-1180, is also available for use as a blocking control in assays to test for specificity of this C1ORF55 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF55 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1orf55

Target: C1orf55 (Chromosome 1 Open Reading Frame 55 (C1orf55))

Andere Bezeichnung: C1ORF55 (C1orf55 Produkte)

Synonyme: C1orf55 antikoerper, RP4-671D7.1 antikoerper, dJ671D7.1 antikoerper, SDE2 antikoerper, c1orf55 antikoerper, DKFZp469F1217 antikoerper, RGD1305572 antikoerper, wu:fb55e02 antikoerper, wu:fi34c02 antikoerper, zgc:112095 antikoerper, SDE2 telomere maintenance homolog antikoerper, SDE2 telomere maintenance homolog (S. pombe) S homeolog antikoerper, SDE2 telomere maintenance homolog (S. pombe) antikoerper, SDE2 antikoerper, sde2.S antikoerper, sde2 antikoerper, Sde2 antikoerper

Hintergrund: C1orf55 is phosphorylated upon DNA damage, probably by ATM or ATR. The exact function of C1orf55 remains unknown.

Molekulargewicht: 50 kDa (MW of target protein)