C1orf55 Antikörper (C-Term)

Produktnummer ABIN631867

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch C1orf55 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für C1orf55 Antikörper (C-Term) (ABIN631867)

Target: C1orf55 (Chromosome 1 Open Reading Frame 55 (C1orf55))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1orf55 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C1orf55 Antikörper

Bindungsspezifität: C-Term

Spezifität: C1 ORF55 antibody was raised against the C terminal Of C1 rf55

Aufreinigung: Affinity purified

Immunogen: C1 ORF55 antibody was raised using the C terminal Of C1 rf55 corresponding to a region with amino acids AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF55 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this C1ORF55 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF55 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1orf55

Target: C1orf55 (Chromosome 1 Open Reading Frame 55 (C1orf55))

Andere Bezeichnung: C1ORF55

Hintergrund: C1orf55 is phosphorylated upon DNA damage, probably by ATM or ATR. The exact function of C1orf55 remains unknown.

Molekulargewicht: 50 kDa (MW of target protein)