KRT8 Antikörper (N-Term)
-
- Target Alle KRT8 Antikörper anzeigen
- KRT8 (Keratin 8 (KRT8))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KRT8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- Cytokeratin 8 antibody was raised against the N terminal of KRT8
- Aufreinigung
- Affinity purified
- Immunogen
- Cytokeratin 8 antibody was raised using the N terminal of KRT8 corresponding to a region with amino acids MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL
- Top Product
- Discover our top product KRT8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cytokeratin 8 Blocking Peptide, catalog no. 33R-6446, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KRT8 (Keratin 8 (KRT8))
- Andere Bezeichnung
- Cytokeratin 8 (KRT8 Produkte)
- Hintergrund
- KRT8 together with KRT19, help to link the contractile apparatus to dystrophin at the costameres of striated muscle.
- Molekulargewicht
- 53 kDa (MW of target protein)
-