PUS10 Antikörper (Middle Region)
-
- Target Alle PUS10 Antikörper anzeigen
- PUS10 (Pseudouridylate Synthase 10 (PUS10))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PUS10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PUS10 antibody was raised against the middle region of PUS10
- Aufreinigung
- Affinity purified
- Immunogen
- PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN
- Top Product
- Discover our top product PUS10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PUS10 Blocking Peptide, catalog no. 33R-1592, is also available for use as a blocking control in assays to test for specificity of this PUS10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUS10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PUS10 (Pseudouridylate Synthase 10 (PUS10))
- Andere Bezeichnung
- PUS10 (PUS10 Produkte)
- Synonyme
- CCDC139 antikoerper, DOBI antikoerper, 2810013G11Rik antikoerper, 4933435A13Rik antikoerper, AU014648 antikoerper, C77560 antikoerper, Ccdc139 antikoerper, RGD1306402 antikoerper, pseudouridylate synthase 10 antikoerper, PUS10 antikoerper, Pus10 antikoerper
- Hintergrund
- Pseudouridination, the isomerization of uridine to pseudouridine, is the most common posttranscriptional nucleotide modification found in RNA and is essential for biologic functions such as spliceosome biogenesis. Pseudouridylate synthases, such as PUS10, catalyze pseudouridination of structural RNAs, including transfer, ribosomal, and splicing RNAs. These enzymes also act as RNA chaperones, facilitating the correct folding and assembly of tRNAs.
- Molekulargewicht
- 60 kDa (MW of target protein)
-