PUS10 Antikörper (Middle Region)

Produktnummer ABIN631863

Dieses Anti-PUS10-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PUS10 in WB. Geeignet für Human.

Kurzübersicht für PUS10 Antikörper (Middle Region) (ABIN631863)

Target: PUS10 (Pseudouridylate Synthase 10 (PUS10))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PUS10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PUS10 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PUS10 antibody was raised against the middle region of PUS10

Aufreinigung: Affinity purified

Immunogen: PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PUS10 Blocking Peptide, (ABIN936978), is also available for use as a blocking control in assays to test for specificity of this PUS10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUS10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PUS10

Target: PUS10 (Pseudouridylate Synthase 10 (PUS10))

Andere Bezeichnung: PUS10

Hintergrund: Pseudouridination, the isomerization of uridine to pseudouridine, is the most common posttranscriptional nucleotide modification found in RNA and is essential for biologic functions such as spliceosome biogenesis. Pseudouridylate synthases, such as PUS10, catalyze pseudouridination of structural RNAs, including transfer, ribosomal, and splicing RNAs. These enzymes also act as RNA chaperones, facilitating the correct folding and assembly of tRNAs.

Molekulargewicht: 60 kDa (MW of target protein)