FLJ37543 Antikörper (N-Term)

Produktnummer ABIN631859

Der Kaninchen Polyklonal Anti-FLJ37543-Antikörper wurde für WB validiert. Er ist geeignet, FLJ37543 in Proben von Human zu detektieren.

Kurzübersicht für FLJ37543 Antikörper (N-Term) (ABIN631859)

Target: FLJ37543 (Hypothetical Protein FLJ37543 (FLJ37543))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FLJ37543 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FLJ37543 Antikörper

Bindungsspezifität: N-Term

Spezifität: FLJ37543 antibody was raised against the N terminal of FLJ37543

Aufreinigung: Affinity purified

Immunogen: FLJ37543 antibody was raised using the N terminal of FLJ37543 corresponding to a region with amino acids MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ37543 Blocking Peptide, (ABIN5613614), is also available for use as a blocking control in assays to test for specificity of this FLJ37543 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ37543 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FLJ37543

Target: FLJ37543 (Hypothetical Protein FLJ37543 (FLJ37543))

Andere Bezeichnung: FLJ37543

Hintergrund: The function of FLJ37543 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 15 kDa (MW of target protein)