CCDC38 Antikörper (N-Term)

Produktnummer ABIN631855

Produktdetails anti-CCDC38 Antikörper

Target: CCDC38 (Coiled-Coil Domain Containing 38 (CCDC38))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC38 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCDC38 antibody was raised against the N terminal of CCDC38

Aufreinigung: Affinity purified

Immunogen: CCDC38 antibody was raised using the N terminal of CCDC38 corresponding to a region with amino acids RERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC38 Blocking Peptide, catalog no. 33R-7886, is also available for use as a blocking control in assays to test for specificity of this CCDC38 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC38 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC38

Target: CCDC38 (Coiled-Coil Domain Containing 38 (CCDC38))

Andere Bezeichnung: CCDC38 (CCDC38 Produkte)

Synonyme: 4933417K05Rik antikoerper, RGD1564046 antikoerper, coiled-coil domain containing 38 antikoerper, CCDC38 antikoerper, Ccdc38 antikoerper

Hintergrund: The specific function of CCDC38 is not yet known.

Molekulargewicht: 65 kDa (MW of target protein)