CCDC38 Antikörper (N-Term)

Produktnummer ABIN631855

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CCDC38 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für CCDC38 Antikörper (N-Term) (ABIN631855)

Target: CCDC38 (Coiled-Coil Domain Containing 38 (CCDC38))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC38 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCDC38 Antikörper

Bindungsspezifität: N-Term

Spezifität: CCDC38 antibody was raised against the N terminal of CCDC38

Aufreinigung: Affinity purified

Immunogen: CCDC38 antibody was raised using the N terminal of CCDC38 corresponding to a region with amino acids RERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC38 Blocking Peptide, (ABIN5612709), is also available for use as a blocking control in assays to test for specificity of this CCDC38 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC38 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC38

Target: CCDC38 (Coiled-Coil Domain Containing 38 (CCDC38))

Andere Bezeichnung: CCDC38

Hintergrund: The specific function of CCDC38 is not yet known.

Molekulargewicht: 65 kDa (MW of target protein)