ALS2CR12 Antikörper

Produktnummer ABIN631852

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ALS2CR12 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für ALS2CR12 Antikörper (ABIN631852)

Target: ALS2CR12 (Amyotrophic Lateral Sclerosis 2 (Juvenile) Chromosome Region, Candidate 12 (ALS2CR12))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALS2CR12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALS2CR12 Antikörper

Aufreinigung: Affinity purified

Immunogen: ALS2 CR12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALS2CR12 Blocking Peptide, (ABIN5612041), is also available for use as a blocking control in assays to test for specificity of this ALS2CR12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALS0 R12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALS2CR12

Target: ALS2CR12 (Amyotrophic Lateral Sclerosis 2 (Juvenile) Chromosome Region, Candidate 12 (ALS2CR12))

Andere Bezeichnung: ALS2CR12

Hintergrund: The function of ALS2CR12 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 52 kDa (MW of target protein)