RFPL2 Antikörper (C-Term)

Produktnummer ABIN631850

Produktdetails anti-RFPL2 Antikörper

Target: RFPL2 (Ret Finger Protein-Like 2 (RFPL2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RFPL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RFPL2 antibody was raised against the C terminal of RFPL2

Aufreinigung: Affinity purified

Immunogen: RFPL2 antibody was raised using the C terminal of RFPL2 corresponding to a region with amino acids VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RFPL2 Blocking Peptide, catalog no. 33R-9802, is also available for use as a blocking control in assays to test for specificity of this RFPL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFPL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RFPL2

Target: RFPL2 (Ret Finger Protein-Like 2 (RFPL2))

Andere Bezeichnung: RFPL2 (RFPL2 Produkte)

Synonyme: RNF79 antikoerper, RFPL2 antikoerper, ret finger protein like 2 antikoerper, ret finger protein-like 2 antikoerper, ret finger protein-like 3 antikoerper, RFPL2 antikoerper, LOC470188 antikoerper, LOC100601334 antikoerper

Hintergrund: RFPL2 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The human RFPL2 gene has a role in neocortex development.

Molekulargewicht: 32 kDa (MW of target protein)