RFPL2 Antikörper (C-Term)

Produktnummer ABIN631850

Der Kaninchen Polyklonal Anti-RFPL2-Antikörper wurde für WB validiert. Er ist geeignet, RFPL2 in Proben von Human zu detektieren.

Kurzübersicht für RFPL2 Antikörper (C-Term) (ABIN631850)

Target: RFPL2 (Ret Finger Protein-Like 2 (RFPL2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RFPL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RFPL2 Antikörper

Bindungsspezifität: C-Term

Spezifität: RFPL2 antibody was raised against the C terminal of RFPL2

Aufreinigung: Affinity purified

Immunogen: RFPL2 antibody was raised using the C terminal of RFPL2 corresponding to a region with amino acids VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RFPL2 Blocking Peptide, (ABIN5615835), is also available for use as a blocking control in assays to test for specificity of this RFPL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFPL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RFPL2

Target: RFPL2 (Ret Finger Protein-Like 2 (RFPL2))

Andere Bezeichnung: RFPL2

Hintergrund: RFPL2 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The human RFPL2 gene has a role in neocortex development.

Molekulargewicht: 32 kDa (MW of target protein)