ROPN1B Antikörper (N-Term)

Produktnummer ABIN631847

Produktdetails anti-ROPN1B Antikörper

Target: ROPN1B (Ropporin, Rhophilin Associated Protein 1B (ROPN1B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ROPN1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ROPN1 B antibody was raised against the N terminal of ROPN1

Aufreinigung: Affinity purified

Immunogen: ROPN1 B antibody was raised using the N terminal of ROPN1 corresponding to a region with amino acids DYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ROPN1B Blocking Peptide, catalog no. 33R-2236, is also available for use as a blocking control in assays to test for specificity of this ROPN1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROPN0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ROPN1B

Target: ROPN1B (Ropporin, Rhophilin Associated Protein 1B (ROPN1B))

Andere Bezeichnung: ROPN1B (ROPN1B Produkte)

Synonyme: rhophilin associated tail protein 1B antikoerper, ROPN1B antikoerper

Hintergrund: ROPN1B belongs to the ropporin family and contains 1 RIIa domain. ROPN1B interacts with RHPN1 and AKAP3. It may interact with SPA17.

Molekulargewicht: 24 kDa (MW of target protein)