THOC6 Antikörper

Produktnummer ABIN631845

Produktdetails anti-THOC6 Antikörper

Target: THOC6 (THO Complex 6 Homolog (THOC6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser THOC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: THOC6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

THOC6 Blocking Peptide, catalog no. 33R-1196, is also available for use as a blocking control in assays to test for specificity of this THOC6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu THOC6

Target: THOC6 (THO Complex 6 Homolog (THOC6))

Andere Bezeichnung: THOC6 (THOC6 Produkte)

Synonyme: WDR58 antikoerper, fSAP35 antikoerper, F830014G06Rik antikoerper, Wdr58 antikoerper, Pdrp antikoerper, zgc:101618 antikoerper, thoc6 antikoerper, THO complex 6 antikoerper, THO complex 6 homolog (Drosophila) antikoerper, THO complex 6 L homeolog antikoerper, THOC6 antikoerper, Thoc6 antikoerper, thoc6 antikoerper, thoc6.L antikoerper

Hintergrund: THOC6 belongs to the WD repeat THOC6 family.It contains 7 WD repeats. The function of the THOC6 protein remains unknown.

Molekulargewicht: 37 kDa (MW of target protein)