THOC6 Antikörper

Produktnummer ABIN631845

Dieser Anti-THOC6 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von THOC6 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für THOC6 Antikörper (ABIN631845)

Target: THOC6 (THO Complex 6 Homolog (THOC6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser THOC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-THOC6 Antikörper

Aufreinigung: Affinity purified

Immunogen: THOC6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

THOC6 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this THOC6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu THOC6

Target: THOC6 (THO Complex 6 Homolog (THOC6))

Andere Bezeichnung: THOC6

Hintergrund: THOC6 belongs to the WD repeat THOC6 family.It contains 7 WD repeats. The function of the THOC6 protein remains unknown.

Molekulargewicht: 37 kDa (MW of target protein)