GNPDA1 Antikörper (C-Term)

Produktnummer ABIN631844

Produktdetails anti-GNPDA1 Antikörper

Target: GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))

Bindungsspezifität: C-Term

Reaktivität: Maus, Human, Ratte, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNPDA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GNPDA1 antibody was raised against the C terminal of GNPDA1

Aufreinigung: Affinity purified

Immunogen: GNPDA1 antibody was raised using the C terminal of GNPDA1 corresponding to a region with amino acids EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNPDA1 Blocking Peptide, catalog no. 33R-2449, is also available for use as a blocking control in assays to test for specificity of this GNPDA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNPDA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNPDA1

Target: GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))

Andere Bezeichnung: GNPDA1 (GNPDA1 Produkte)

Synonyme: GNP1 antikoerper, GNPDA antikoerper, GNPI antikoerper, GPI antikoerper, HLN antikoerper, Gnp1 antikoerper, Gnpi antikoerper, oscillin antikoerper, gnpda antikoerper, gnpi antikoerper, gpi antikoerper, hln antikoerper, GNPDA1 antikoerper, zgc:110691 antikoerper, glucosamine-6-phosphate deaminase 1 antikoerper, glucosamine-6-phosphate deaminase 1 S homeolog antikoerper, Glucosamine-6-phosphate deaminase 1 antikoerper, GNPDA1 antikoerper, Gnpda1 antikoerper, gnpda1.S antikoerper, gnpda1 antikoerper, MSMEG_0501 antikoerper, nagB antikoerper, PPSC2_c4268 antikoerper

Hintergrund: GNPDA1 belongs to the glucosamine/galactosamine-6-phosphate isomerase family.It seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo.

Molekulargewicht: 33 kDa (MW of target protein)