GNPDA1 Antikörper (C-Term)

Produktnummer ABIN631844

Der Kaninchen Polyklonal Anti-GNPDA1-Antikörper wurde für WB validiert. Er ist geeignet, GNPDA1 in Proben von Human, Maus, Ratte und C. elegans zu detektieren.

Kurzübersicht für GNPDA1 Antikörper (C-Term) (ABIN631844)

Target: GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))

Reaktivität: Human, Maus, Ratte, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNPDA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GNPDA1 Antikörper

Bindungsspezifität: C-Term

Spezifität: GNPDA1 antibody was raised against the C terminal of GNPDA1

Aufreinigung: Affinity purified

Immunogen: GNPDA1 antibody was raised using the C terminal of GNPDA1 corresponding to a region with amino acids EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNPDA1 Blocking Peptide, (ABIN937835), is also available for use as a blocking control in assays to test for specificity of this GNPDA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNPDA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNPDA1

Target: GNPDA1 (Glucosamine-6-Phosphate Deaminase 1 (GNPDA1))

Andere Bezeichnung: GNPDA1

Hintergrund: GNPDA1 belongs to the glucosamine/galactosamine-6-phosphate isomerase family.It seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo.

Molekulargewicht: 33 kDa (MW of target protein)