Phosphoglucomutase 3 Antikörper (Middle Region)

Produktnummer ABIN631841

Der Kaninchen Polyklonal Anti-Phosphoglucomutase 3-Antikörper wurde für WB validiert. Er ist geeignet, Phosphoglucomutase 3 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Phosphoglucomutase 3 Antikörper (Middle Region) (ABIN631841)

Target: Phosphoglucomutase 3 (PGM3)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Phosphoglucomutase 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Phosphoglucomutase 3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PGM3 antibody was raised against the middle region of PGM3

Aufreinigung: Affinity purified

Immunogen: PGM3 antibody was raised using the middle region of PGM3 corresponding to a region with amino acids GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGM3 Blocking Peptide, (ABIN939046), is also available for use as a blocking control in assays to test for specificity of this PGM3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Phosphoglucomutase 3

Target: Phosphoglucomutase 3 (PGM3)

Andere Bezeichnung: PGM3

Hintergrund: PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Molekulargewicht: 60 kDa (MW of target protein)