PRRC1 Antikörper (Middle Region)

Produktnummer ABIN631835

Der Kaninchen Polyklonal anti-PRRC1 Antikörper wird verwendet zum Nachweis von PRRC1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für PRRC1 Antikörper (Middle Region) (ABIN631835)

Target: PRRC1 (Proline-Rich Coiled-Coil 1 (PRRC1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRRC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PRRC1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PRRC1 antibody was raised against the middle region of PRRC1

Aufreinigung: Affinity purified

Immunogen: PRRC1 antibody was raised using the middle region of PRRC1 corresponding to a region with amino acids VGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRRC1 Blocking Peptide, (ABIN5615596), is also available for use as a blocking control in assays to test for specificity of this PRRC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRRC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRRC1

Target: PRRC1 (Proline-Rich Coiled-Coil 1 (PRRC1))

Andere Bezeichnung: PRRC1

Hintergrund: The specific function of PRRC1 is not yet known.

Molekulargewicht: 47 kDa (MW of target protein)