PYROXD2 Antikörper (N-Term)
-
- Target Alle PYROXD2 (C10ORF33) Antikörper anzeigen
- PYROXD2 (C10ORF33) (Chromosome 10 Open Reading Frame 33 (C10ORF33))
-
Bindungsspezifität
- N-Term
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PYROXD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C10 ORF33 antibody was raised against the N terminal Of C10 rf33
- Aufreinigung
- Affinity purified
- Immunogen
- C10 ORF33 antibody was raised using the N terminal Of C10 rf33 corresponding to a region with amino acids MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVIGAGHNGLVAA
- Top Product
- Discover our top product C10ORF33 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C10ORF33 Blocking Peptide, catalog no. 33R-5610, is also available for use as a blocking control in assays to test for specificity of this C10ORF33 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF33 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PYROXD2 (C10ORF33) (Chromosome 10 Open Reading Frame 33 (C10ORF33))
- Andere Bezeichnung
- C10ORF33 (C10ORF33 Produkte)
- Synonyme
- C10orf33 antikoerper, DKFZp469H0233 antikoerper, FP3420 antikoerper, C26H10orf33 antikoerper, 3830409H07Rik antikoerper, 4833409A17Rik antikoerper, RGD1303232 antikoerper, pyridine nucleotide-disulphide oxidoreductase domain 2 antikoerper, PYROXD2 antikoerper, Pyroxd2 antikoerper
- Hintergrund
- C10orf33 is probably involved in oxidoreductase activity.
- Molekulargewicht
- 63 kDa (MW of target protein)
-