NOP16 Antikörper (Middle Region)

Produktnummer ABIN631833

Der Kaninchen Polyklonal anti-NOP16 Antikörper (ABIN631833) detektiert spezifisch NOP16 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für NOP16 Antikörper (Middle Region) (ABIN631833)

Target: NOP16 (Nucleolar Protein 16 (NOP16))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOP16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NOP16 Antikörper

Bindungsspezifität: Middle Region

Spezifität: HSPC111 antibody was raised against the middle region of HSPC111

Aufreinigung: Affinity purified

Immunogen: HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPC111 Blocking Peptide, (ABIN5614109), is also available for use as a blocking control in assays to test for specificity of this HSPC111 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPC111 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOP16

Target: NOP16 (Nucleolar Protein 16 (NOP16))

Andere Bezeichnung: HSPC111

Hintergrund: NOP16 is transcriptionally regulated by c-Myc, upregulated in breast cancer, and overexpression is associated with poor patient survival.

Molekulargewicht: 21 kDa (MW of target protein)