ANKLE2 Antikörper (Middle Region)

Produktnummer ABIN631827

Produktdetails anti-ANKLE2 Antikörper

Target: ANKLE2 (Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANKLE2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIAA0692 antibody was raised against the middle region of Kiaa0692

Aufreinigung: Affinity purified

Immunogen: KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA0692 Blocking Peptide, catalog no. 33R-1839, is also available for use as a blocking control in assays to test for specificity of this KIAA0692 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0692 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANKLE2

Target: ANKLE2 (Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2))

Andere Bezeichnung: KIAA0692 (ANKLE2 Produkte)

Synonyme: KIAA0692 antikoerper, LEMD7 antikoerper, Lem4 antikoerper, 1110001J12Rik antikoerper, AI661024 antikoerper, D5Ertd585e antikoerper, RGD1310191 antikoerper, ankyrin repeat and LEM domain containing 2 antikoerper, ANKLE2 antikoerper, Ankle2 antikoerper

Hintergrund: KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown.

Molekulargewicht: 104 kDa (MW of target protein)