ANKLE2 Antikörper (Middle Region)
-
- Target Alle ANKLE2 Produkte
- ANKLE2 (Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ANKLE2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIAA0692 antibody was raised against the middle region of Kiaa0692
- Aufreinigung
- Affinity purified
- Immunogen
- KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIAA0692 Blocking Peptide, catalog no. 33R-1839, is also available for use as a blocking control in assays to test for specificity of this KIAA0692 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0692 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANKLE2 (Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2))
- Andere Bezeichnung
- KIAA0692 (ANKLE2 Produkte)
- Hintergrund
- KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown.
- Molekulargewicht
- 104 kDa (MW of target protein)
-