MUC3B Antikörper (N-Term)
Kurzübersicht für MUC3B Antikörper (N-Term) (ABIN631826)
Target
Reaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- MUC3 B antibody was raised against the N terminal of MUC3
-
Aufreinigung
- Affinity purified
-
Immunogen
- MUC3 B antibody was raised using the N terminal of MUC3 corresponding to a region with amino acids KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
MUC3B Blocking Peptide, (ABIN940035), is also available for use as a blocking control in assays to test for specificity of this MUC3B antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC0 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))
-
Andere Bezeichnung
- MUC3B
-
Hintergrund
- MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
-
Molekulargewicht
- 34 kDa (MW of target protein)
Target
-