FBXW10 Antikörper (N-Term)

Produktnummer ABIN631823

Produktdetails anti-FBXW10 Antikörper

Target: FBXW10 (F-Box and WD Repeat Domain Containing 10 (FBXW10))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXW10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXW10 antibody was raised against the N terminal of FBXW10

Aufreinigung: Affinity purified

Immunogen: FBXW10 antibody was raised using the N terminal of FBXW10 corresponding to a region with amino acids SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXW10 Blocking Peptide, catalog no. 33R-8670, is also available for use as a blocking control in assays to test for specificity of this FBXW10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXW10

Target: FBXW10 (F-Box and WD Repeat Domain Containing 10 (FBXW10))

Andere Bezeichnung: FBXW10 (FBXW10 Produkte)

Synonyme: Fbw10 antikoerper, HREP antikoerper, SM25H2 antikoerper, SM2SH2 antikoerper, CMT1A duplicated region transcript 1 antikoerper, F-box and WD repeat domain containing 10 antikoerper, tripartite motif containing 16 antikoerper, F-box and WD-40 domain protein 10 antikoerper, CDRT1 antikoerper, FBXW10 antikoerper, Fbxw10 antikoerper, Cdrt1 antikoerper, TRIM16 antikoerper

Hintergrund: Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molekulargewicht: 120 kDa (MW of target protein)