FBXW10 Antikörper (N-Term)
-
- Target Alle FBXW10 Antikörper anzeigen
- FBXW10 (F-Box and WD Repeat Domain Containing 10 (FBXW10))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXW10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXW10 antibody was raised against the N terminal of FBXW10
- Aufreinigung
- Affinity purified
- Immunogen
- FBXW10 antibody was raised using the N terminal of FBXW10 corresponding to a region with amino acids SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXW10 Blocking Peptide, catalog no. 33R-8670, is also available for use as a blocking control in assays to test for specificity of this FBXW10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXW10 (F-Box and WD Repeat Domain Containing 10 (FBXW10))
- Andere Bezeichnung
- FBXW10 (FBXW10 Produkte)
- Hintergrund
- Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
- Molekulargewicht
- 120 kDa (MW of target protein)
-