RAD17 Antikörper

Produktnummer ABIN631819

Produktdetails anti-RAD17 Antikörper

Target: RAD17

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAD17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RAD17 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAD17 Blocking Peptide, catalog no. 33R-6262, is also available for use as a blocking control in assays to test for specificity of this RAD17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAD17

Target: RAD17

Andere Bezeichnung: RAD17 (RAD17 Produkte)

Synonyme: zgc:91969 antikoerper, RAD17 antikoerper, K2A18.21 antikoerper, K2A18_21 antikoerper, RADIATION SENSITIVE 17 antikoerper, CCYC antikoerper, HRAD17 antikoerper, R24L antikoerper, RAD17SP antikoerper, RAD24 antikoerper, 9430035O09Rik antikoerper, MmRad24 antikoerper, RAD17 checkpoint clamp loader component antikoerper, Rad17p antikoerper, RADIATION SENSITIVE 17 antikoerper, RAD17 antikoerper, rad17 antikoerper, ATRAD17 antikoerper, Rad17 antikoerper

Hintergrund: RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs.

Molekulargewicht: 76 kDa (MW of target protein)