STAMBPL1 Antikörper (N-Term)

Produktnummer ABIN631818

Dieses Anti-STAMBPL1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von STAMBPL1 in WB. Geeignet für Human.

Kurzübersicht für STAMBPL1 Antikörper (N-Term) (ABIN631818)

Target: STAMBPL1 (STAM Binding Protein-Like 1 (STAMBPL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STAMBPL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-STAMBPL1 Antikörper

Bindungsspezifität: N-Term

Spezifität: STAMBPL1 antibody was raised against the N terminal of STAMBPL1

Aufreinigung: Affinity purified

Immunogen: STAMBPL1 antibody was raised using the N terminal of STAMBPL1 corresponding to a region with amino acids MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STAMBPL1 Blocking Peptide, (ABIN5616412), is also available for use as a blocking control in assays to test for specificity of this STAMBPL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAMBPL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STAMBPL1

Target: STAMBPL1 (STAM Binding Protein-Like 1 (STAMBPL1))

Andere Bezeichnung: STAMBPL1

Hintergrund: STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.

Molekulargewicht: 50 kDa (MW of target protein)