STAMBPL1 Antikörper (N-Term)
Kurzübersicht für STAMBPL1 Antikörper (N-Term) (ABIN631818)
Target
Alle STAMBPL1 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- STAMBPL1 antibody was raised against the N terminal of STAMBPL1
-
Aufreinigung
- Affinity purified
-
Immunogen
- STAMBPL1 antibody was raised using the N terminal of STAMBPL1 corresponding to a region with amino acids MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
STAMBPL1 Blocking Peptide, (ABIN5616412), is also available for use as a blocking control in assays to test for specificity of this STAMBPL1 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAMBPL1 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- STAMBPL1 (STAM Binding Protein-Like 1 (STAMBPL1))
-
Andere Bezeichnung
- STAMBPL1
-
Hintergrund
- STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.
-
Molekulargewicht
- 50 kDa (MW of target protein)
Target
-