KRTAP11-1 Antikörper (N-Term)

Produktnummer ABIN631812

Dieses Anti-KRTAP11-1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von KRTAP11-1 in WB. Geeignet für Human.

Kurzübersicht für KRTAP11-1 Antikörper (N-Term) (ABIN631812)

Target: KRTAP11-1 (Keratin Associated Protein 11-1 (KRTAP11-1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRTAP11-1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KRTAP11-1 Antikörper

Bindungsspezifität: N-Term

Spezifität: KAP11.1 antibody was raised against the N terminal of KRTAP11-1

Aufreinigung: Affinity purified

Immunogen: KAP11.1 antibody was raised using the N terminal of KRTAP11-1 corresponding to a region with amino acids SFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KAP11.1 Blocking Peptide, (ABIN5614249), is also available for use as a blocking control in assays to test for specificity of this KAP11.1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRTAP11-1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KRTAP11-1

Target: KRTAP11-1 (Keratin Associated Protein 11-1 (KRTAP11-1))

Andere Bezeichnung: KAP11.1

Hintergrund: KRTAP11-1 belongs to the PMG family. In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Molekulargewicht: 17 kDa (MW of target protein)