MPV17L Antikörper (N-Term)
-
- Target Alle MPV17L Antikörper anzeigen
- MPV17L (MPV17 Mitochondrial Membrane Protein-Like (MPV17L))
- Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MPV17L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MPV17 L antibody was raised against the N terminal of MPV17
- Aufreinigung
- Affinity purified
- Immunogen
- MPV17 L antibody was raised using the N terminal of MPV17 corresponding to a region with amino acids MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MPV17L Blocking Peptide, catalog no. 33R-5673, is also available for use as a blocking control in assays to test for specificity of this MPV17L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPV10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPV17L (MPV17 Mitochondrial Membrane Protein-Like (MPV17L))
- Andere Bezeichnung
- MPV17L (MPV17L Produkte)
- Hintergrund
- Isoform 1 participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes.
- Molekulargewicht
- 17 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-