ALOX12 Antikörper (C-Term)

Produktnummer ABIN631808

Der Kaninchen Polyklonal Anti-ALOX12-Antikörper wurde für WB validiert. Er ist geeignet, ALOX12 in Proben von Human zu detektieren.

Kurzübersicht für ALOX12 Antikörper (C-Term) (ABIN631808)

Target: ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALOX12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALOX12 Antikörper

Bindungsspezifität: C-Term

Spezifität: ALOX12 antibody was raised against the C terminal of ALOX12

Aufreinigung: Affinity purified

Immunogen: ALOX12 antibody was raised using the C terminal of ALOX12 corresponding to a region with amino acids MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALOX12 Blocking Peptide, (ABIN5612028), is also available for use as a blocking control in assays to test for specificity of this ALOX12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALOX12

Target: ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))

Andere Bezeichnung: ALOX12

Hintergrund: ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.

Molekulargewicht: 76 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity