HIPK4 Antikörper (Middle Region)

Produktnummer ABIN631807

Produktdetails anti-HIPK4 Antikörper

Target: HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HIPK4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HIPK4 antibody was raised against the middle region of HIPK4

Aufreinigung: Affinity purified

Immunogen: HIPK4 antibody was raised using the middle region of HIPK4 corresponding to a region with amino acids AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HIPK4 Blocking Peptide, catalog no. 33R-1123, is also available for use as a blocking control in assays to test for specificity of this HIPK4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIPK4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HIPK4

Target: HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))

Andere Bezeichnung: HIPK4 (HIPK4 Produkte)

Synonyme: Gm162 antikoerper, homeodomain interacting protein kinase 4 antikoerper, HIPK4 antikoerper, Hipk4 antikoerper

Hintergrund: HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors.

Molekulargewicht: 69 kDa (MW of target protein)