LRRC57 Antikörper (N-Term)

Produktnummer ABIN631803

Dieses Anti-LRRC57-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von LRRC57 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für LRRC57 Antikörper (N-Term) (ABIN631803)

Target: LRRC57 (Leucine Rich Repeat Containing 57 (LRRC57))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC57 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LRRC57 Antikörper

Bindungsspezifität: N-Term

Spezifität: LRRC57 antibody was raised against the N terminal of LRRC57

Aufreinigung: Affinity purified

Immunogen: LRRC57 antibody was raised using the N terminal of LRRC57 corresponding to a region with amino acids MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC57 Blocking Peptide, (ABIN5614581), is also available for use as a blocking control in assays to test for specificity of this LRRC57 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC57 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC57

Target: LRRC57 (Leucine Rich Repeat Containing 57 (LRRC57))

Andere Bezeichnung: LRRC57

Hintergrund: LRRC57 is a member of the leucine-rich repeat family of proteins, which are known to be involved in protein-protein interactions.

Molekulargewicht: 27 kDa (MW of target protein)