KRT17 Antikörper (C-Term)

Produktnummer ABIN631802

Produktdetails anti-KRT17 Antikörper

Target: KRT17 (Keratin 17 (KRT17))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRT17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Cytokeratin 17 antibody was raised against the C terminal of KRT17

Aufreinigung: Affinity purified

Immunogen: Cytokeratin 17 antibody was raised using the C terminal of KRT17 corresponding to a region with amino acids IATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKVISSREQVHQT

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cytokeratin 17 Blocking Peptide, catalog no. 33R-3900, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KRT17

Target: KRT17 (Keratin 17 (KRT17))

Andere Bezeichnung: Cytokeratin 17 (KRT17 Produkte)

Synonyme: K17 antikoerper, Krt1-17 antikoerper, PC antikoerper, PC2 antikoerper, PCHC1 antikoerper, Ka17 antikoerper, KRT17 antikoerper, krt16 antikoerper, si:dkeyp-113d7.7 antikoerper, KRT14 antikoerper, keratin 17 antikoerper, keratin 17 L homeolog antikoerper, keratin 17, type I antikoerper, keratin, type I cytoskeletal 17 antikoerper, Krt17 antikoerper, KRT17 antikoerper, krt17 antikoerper, krt17.L antikoerper, LOC100737113 antikoerper, LOC102177275 antikoerper

Hintergrund: KRT17 is type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in its gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.KRT17 encodes the type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in this gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.

Molekulargewicht: 48 kDa (MW of target protein)