KRT17 Antikörper (C-Term)

Produktnummer ABIN631802

Der Kaninchen Polyklonal Anti-KRT17-Antikörper wurde für WB und IHC validiert. Er ist geeignet, KRT17 in Proben von Human, Ratte, Maus und Hund zu detektieren.

Kurzübersicht für KRT17 Antikörper (C-Term) (ABIN631802)

Target: KRT17 (Keratin 17 (KRT17))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRT17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-KRT17 Antikörper

Bindungsspezifität: C-Term

Spezifität: Cytokeratin 17 antibody was raised against the C terminal of KRT17

Aufreinigung: Affinity purified

Immunogen: Cytokeratin 17 antibody was raised using the C terminal of KRT17 corresponding to a region with amino acids IATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKVISSREQVHQT

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cytokeratin 17 Blocking Peptide, (ABIN939286), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KRT17

Target: KRT17 (Keratin 17 (KRT17))

Andere Bezeichnung: Cytokeratin 17

Hintergrund: KRT17 is type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in its gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.KRT17 encodes the type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in this gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.

Molekulargewicht: 48 kDa (MW of target protein)