C7orf43 Antikörper (Middle Region)

Produktnummer ABIN631797

Der Kaninchen Polyklonal anti-C7orf43 Antikörper (ABIN631797) detektiert spezifisch C7orf43 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für C7orf43 Antikörper (Middle Region) (ABIN631797)

Target: C7orf43 (Chromosome 7 Open Reading Frame 43 (C7orf43))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C7orf43 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C7orf43 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C7 ORF43 antibody was raised against the middle region of C7 rf43

Aufreinigung: Affinity purified

Immunogen: C7 ORF43 antibody was raised using the middle region of C7 rf43 corresponding to a region with amino acids DLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C7ORF43 Blocking Peptide, (ABIN937457), is also available for use as a blocking control in assays to test for specificity of this C7ORF43 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF43 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C7orf43

Target: C7orf43 (Chromosome 7 Open Reading Frame 43 (C7orf43))

Andere Bezeichnung: C7ORF43

Hintergrund: The function of Chromosome 7 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 62 kDa (MW of target protein)