ATXN7L1 Antikörper (Middle Region)

Produktnummer ABIN631793

Produktdetails anti-ATXN7L1 Antikörper

Target: ATXN7L1 (Ataxin 7-Like 1 (ATXN7L1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATXN7L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATXN7 L1 antibody was raised against the middle region of ATXN7 1

Aufreinigung: Affinity purified

Immunogen: ATXN7 L1 antibody was raised using the middle region of ATXN7 1 corresponding to a region with amino acids KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATXN7L1 Blocking Peptide, catalog no. 33R-4717, is also available for use as a blocking control in assays to test for specificity of this ATXN7L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATXN0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATXN7L1

Target: ATXN7L1 (Ataxin 7-Like 1 (ATXN7L1))

Andere Bezeichnung: ATXN7L1 (ATXN7L1 Produkte)

Synonyme: ATXN7L4 antikoerper, 2810423G08Rik antikoerper, Atxn7l4 antikoerper, ATXN7L1 antikoerper, RGD1305730 antikoerper, RGD1564242 antikoerper, ataxin 7 like 1 antikoerper, ataxin 7-like 1 antikoerper, ataxin-7-like protein 1 antikoerper, ATXN7L1 antikoerper, Atxn7l1 antikoerper, atxn7l1 antikoerper, LOC100598692 antikoerper

Hintergrund: The function of ATXN7L1 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 16 kDa (MW of target protein)