LOC284009 Antikörper (N-Term)

Produktnummer ABIN631790

Produktdetails anti-LOC284009 Antikörper

Target: LOC284009 (Hypothetical Protein LOC284009 (LOC284009))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LOC284009 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LOC284009 antibody was raised against the N terminal of LOC284009

Aufreinigung: Affinity purified

Immunogen: LOC284009 antibody was raised using the N terminal of LOC284009 corresponding to a region with amino acids IRCGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVPFLAQGIPDI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOC284009 Blocking Peptide, catalog no. 33R-4129, is also available for use as a blocking control in assays to test for specificity of this LOC284009 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC284009 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LOC284009

Target: LOC284009 (Hypothetical Protein LOC284009 (LOC284009))

Andere Bezeichnung: LOC284009 (LOC284009 Produkte)

Hintergrund: The function of LOC284009 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 17 kDa (MW of target protein)