DCAF12 Antikörper (N-Term)

Produktnummer ABIN631786

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DCAF12 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für DCAF12 Antikörper (N-Term) (ABIN631786)

Target: DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCAF12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DCAF12 Antikörper

Bindungsspezifität: N-Term

Spezifität: WDR40 A antibody was raised against the N terminal of WDR40

Aufreinigung: Affinity purified

Immunogen: WDR40 A antibody was raised using the N terminal of WDR40 corresponding to a region with amino acids ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR40A Blocking Peptide, (ABIN936867), is also available for use as a blocking control in assays to test for specificity of this WDR40A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCAF12

Target: DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))

Andere Bezeichnung: WDR40A

Hintergrund: WDR40A is believed to be involved in protein binding.

Molekulargewicht: 50 kDa (MW of target protein)