RPL10A Antikörper (Middle Region)
-
- Target Alle RPL10A Antikörper anzeigen
- RPL10A (Ribosomal Protein L10a (RPL10A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPL10A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPL10 A antibody was raised against the middle region of RPL10
- Aufreinigung
- Affinity purified
- Immunogen
- RPL10 A antibody was raised using the middle region of RPL10 corresponding to a region with amino acids YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK
- Top Product
- Discover our top product RPL10A Primärantikörper
-
anti-Ribosomal Protein L10a (RPL10A) (AA 1-110) antibody
RPL10A Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein L10a (RPL10A) antibodyRPL10A Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein L10a (RPL10A) (C-Term) antibodyRPL10A Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein L10a (RPL10A) (AA 3-31), (N-Term) antibodyRPL10A Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB37030 unconjugated
anti-Ribosomal Protein L10a (RPL10A) (AA 1-217) antibodyRPL10A Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein L10a (RPL10A) (AA 107-156) antibodyRPL10A Reaktivität: Human, Maus, Ratte, Meerschweinchen, Pferd, Rind (Kuh), Kaninchen, Hund, Zebrafisch (Danio rerio), Ziege, Xenopus laevis, Affe, Fledermaus, Schwein, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein L10a (RPL10A) (N-Term) antibodyRPL10A Reaktivität: Human, Maus, Ratte, Meerschweinchen, Pferd, Rind (Kuh), Kaninchen, Hund, Xenopus laevis, Affe, Fledermaus, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPL10A Blocking Peptide, catalog no. 33R-10063, is also available for use as a blocking control in assays to test for specificity of this RPL10A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPL10A (Ribosomal Protein L10a (RPL10A))
- Andere Bezeichnung
- RPL10A (RPL10A Produkte)
- Synonyme
- Csa-19 antikoerper, L10A antikoerper, NEDD6 antikoerper, CsA-19 antikoerper, Nedd6 antikoerper, wu:fb94f08 antikoerper, zgc:73082 antikoerper, zgc:86881 antikoerper, ribosomal protein L10a antikoerper, ribosomal protein L10A antikoerper, ribosomal protein L10a S homeolog antikoerper, RPL10A antikoerper, Rpl10a antikoerper, rpl10a antikoerper, rpl10a.S antikoerper
- Hintergrund
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm.
- Molekulargewicht
- 25 kDa (MW of target protein)
-
