RPL10A Antikörper (Middle Region)

Produktnummer ABIN631783

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RPL10A in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für RPL10A Antikörper (Middle Region) (ABIN631783)

Target: RPL10A (Ribosomal Protein L10a (RPL10A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL10A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPL10A Antikörper

Bindungsspezifität: Middle Region

Spezifität: RPL10 A antibody was raised against the middle region of RPL10

Aufreinigung: Affinity purified

Immunogen: RPL10 A antibody was raised using the middle region of RPL10 corresponding to a region with amino acids YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL10A Blocking Peptide, (ABIN936021), is also available for use as a blocking control in assays to test for specificity of this RPL10A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL10A

Target: RPL10A (Ribosomal Protein L10a (RPL10A))

Andere Bezeichnung: RPL10A

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm.

Molekulargewicht: 25 kDa (MW of target protein)